PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G2252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 208aa    MW: 24270.2 Da    PI: 7.4474
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G2252genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
      Gh_D07G2252 15 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.92.1e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE+ l+ ++++++G++ W++Ia++++ gRt++++k++w++
      Gh_D07G2252  68 RGNITPEEQFLIMELHTKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23765IPR009057Homeodomain-like
PROSITE profilePS5129415.4111062IPR017930Myb domain
SuperFamilySSF466892.25E-3013109IPR009057Homeodomain-like
SMARTSM007177.2E-131464IPR001005SANT/Myb domain
PfamPF002492.6E-161562IPR001005SANT/Myb domain
CDDcd001676.09E-101762No hitNo description
PROSITE profilePS5129423.88263117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2466117IPR009057Homeodomain-like
SMARTSM007172.5E-1467115IPR001005SANT/Myb domain
PfamPF002492.5E-1568111IPR001005SANT/Myb domain
CDDcd001672.96E-1172111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MDKKPCKSQE VEVRKGPWTM EEDLILINYI ANHGEGVWNS LAKAAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQFLIM ELHTKWGNRW SKIAKHLPGR TDNEIKNYWR TRIQKHMNKP  120
AEVCYSNQSD CELLDQQASS SQLPTNTTNA DFMGTSYSPL SSFDYYNNIE AFSGQQQQQQ  180
IMLQSPSNQE DNYWNMEDIW SMQILNGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-261211524126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.225370.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9234740.0JQ923474.1 Gossypium hirsutum MYB24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444424.11e-157PREDICTED: myb-related protein 340 isoform X1
SwissprotP813918e-92MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0D2Q4P31e-157A0A0D2Q4P3_G
STRINGVIT_14s0066g01090.t011e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.13e-86myb domain protein 24